RetrogeneDB ID: | retro_dnov_613 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_6832:45333..45762(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NECAP1 | ||
Ensembl ID: | ENSDNOG00000014778 | ||
Aliases: | None | ||
Description: | NECAP endocytosis associated 1 [Source:HGNC Symbol;Acc:24539] |
Percent Identity: | 73.97 % |
Parental protein coverage: | 53.09 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VKQESEISKESQEMDTRPKLDLGFKEGQTIKLSIGSITTKKGGTSKPKTSGTGGLSLLPPPPGGKVTIPP |
...E.EISKE.QE....PKLDL.F.EGQT..LSIG.ITTKKGG.SKPKTS..GGLSL.PPP..GKVT.P. | |
Retrocopy | IQHEPEISKECQETENHPKLDLSFQEGQTNELSIGNITTKKGGASKPKTSEAGGLSL-PPPLPGKVTLPL |
Parental | LSSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVTTPAPAPVSAGNDLWGDFSTASSSVSNQAPQP |
.SSSVAISNHV.P..IPKSNHGGSDADILLDLDS.AP....AP.PVS.GNDLWGDFST.S.SVSNQ.PQ. | |
Retrocopy | SSSSVAISNHVIPSSIPKSNHGGSDADILLDLDSTAPIM--APTPVSLGNDLWGDFSTVSCSVSNQTPQS |
Parental | SNWVQF |
S.WVQF | |
Retrocopy | SKWVQF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 24 .89 RPM |
SRP012922_cerebellum | 0 .00 RPM | 106 .81 RPM |
SRP012922_heart | 0 .00 RPM | 7 .19 RPM |
SRP012922_kidney | 0 .00 RPM | 10 .68 RPM |
SRP012922_liver | 0 .00 RPM | 14 .71 RPM |
SRP012922_lung | 0 .00 RPM | 12 .07 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 7 .44 RPM |
SRP012922_spleen | 0 .00 RPM | 21 .06 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016989 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000013930 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000008087 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000014778 | 2 retrocopies |
retro_dnov_613 , retro_dnov_986,
|
Homo sapiens | ENSG00000089818 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000010233 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000002979 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000016742 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001743 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004309 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000006358 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004238 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000023277 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000009236 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010153 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000014260 | 1 retrocopy |