RetrogeneDB ID: | retro_cjac_1330 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 15:30641822..30642037(+) | ||
Located in intron of: | ENSCJAG00000007622 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFB1 | ||
Ensembl ID: | ENSCJAG00000018067 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa [Source:HGNC Symbol;Acc:7695] |
Percent Identity: | 78.08 % |
Parental protein coverage: | 67.92 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | LGVPVAVATGPAAIMVNFLQL-LRDQWVVLFVPMGFVLGCYLDRKNDEKLTAFRNKSMLYKRELRPNEEY |
LG.PV.VATGPAAIMV.FLQL...DQWV..F.PMGF.LGCYLDRKNDE.LTAF.NKSM..KRELRPNE.. | |
Retrocopy | LGSPVSVATGPAAIMVSFLQL<VWDQWVLPFAPMGFILGCYLDRKNDENLTAFWNKSM*DKRELRPNEVC |
Parental | TWK |
TWK | |
Retrocopy | TWK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 9 .61 RPM |
SRP051959_heart | 0 .02 RPM | 23 .71 RPM |
SRP051959_kidney | 0 .00 RPM | 19 .21 RPM |
SRP051959_liver | 0 .00 RPM | 16 .57 RPM |
SRP051959_lung | 0 .02 RPM | 7 .58 RPM |
SRP051959_lymph_node | 0 .11 RPM | 9 .29 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 33 .59 RPM |
SRP051959_spleen | 0 .27 RPM | 11 .01 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000014837 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000018067 | 5 retrocopies | |
Homo sapiens | ENSG00000183648 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000022428 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000017129 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000012731 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000006076 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000006649 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000015319 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000008130 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000003502 | 2 retrocopies |