RetrogeneDB ID: | retro_ttru_830 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | GeneScaffold_359:242314..242550(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB1 | ||
| Ensembl ID: | ENSTTRG00000008130 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa [Source:HGNC Symbol;Acc:7695] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 75.24 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | VAGLTAALGRGLVVVPEASAFMMNLLQIVRDHWVHILVPVGFVVGCYLDRKNDEKLIAFRNKSLLYKR-E |
| VAGLTAALGRG.VV...A.AFMMNLLQ.VRD.WVHIL.P.GFV.GC.LDRK.DEKL..F.NKSLL.KR.E | |
| Retrocopy | VAGLTAALGRGVVVGTKAPAFMMNLLQTVRDYWVHILAPLGFVFGCCLDRKHDEKLTGFWNKSLLFKR<E |
| Parental | LTPSEEVTWK |
| L.P.EEV.WK | |
| Retrocopy | LRPNEEVIWK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014837 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018067 | 5 retrocopies | |
| Homo sapiens | ENSG00000183648 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000022428 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000017129 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012731 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006076 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006649 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000015319 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000008130 | 2 retrocopies |
retro_ttru_1515, retro_ttru_830 ,
|
| Vicugna pacos | ENSVPAG00000003502 | 2 retrocopies |