RetrogeneDB ID: | retro_cjac_2962 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 7:9152298..9152655(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000005579 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65.04 % |
Parental protein coverage: | 78.43 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | LHIVLLSIP-FFSVPVAWTLTNIIHNLGMYVFLHAVKG-TPFETPDQGKARLLTHWEQLDYGVQFTSSRK |
.HIV.LSIP..F.V..A.TL.N..HNLGM..FL.A.KG.TP.ETPDQGKA.L.TH.EQL..G....SSRK | |
Retrocopy | VHIVSLSIP<LFDVLIA*TLANAVHNLGMNGFLCACKG<TPLETPDQGKAGLPTHGEQLEDGIPSASSRK |
Parental | FFTISPIILYFLASFYT-KYDSTHFILNTASLLSVLIPKMPQLHGVRIFGINK |
F.TISPIILYF.ASFY..KY..T..IL.TASL.S.L...MP..HGV.IFGINK | |
Retrocopy | FPTISPIILYFPASFYR<KYNPTRTILSTASLPSMLTLQMPRRHGVPIFGINK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 12 .14 RPM |
SRP051959_heart | 0 .02 RPM | 17 .98 RPM |
SRP051959_kidney | 0 .00 RPM | 16 .06 RPM |
SRP051959_liver | 0 .00 RPM | 17 .59 RPM |
SRP051959_lung | 0 .10 RPM | 14 .01 RPM |
SRP051959_lymph_node | 0 .00 RPM | 16 .07 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 15 .77 RPM |
SRP051959_spleen | 0 .00 RPM | 18 .42 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000005579 | 1 retrocopy |
retro_cjac_2962 ,
|
Homo sapiens | ENSG00000128699 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000015259 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000007769 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000014339 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000014316 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006625 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000013017 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000012736 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000016044 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000012942 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005240 | 2 retrocopies |