RetrogeneDB ID: | retro_mmul_2432 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 9:11015421..11015773(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.12783 | ||
Ensembl ID: | ENSMMUG00000014316 | ||
Aliases: | None | ||
Description: | ORM1-like protein 1 [Source:RefSeq peptide;Acc:NP_001253278] |
Percent Identity: | 72.95 % |
Parental protein coverage: | 77.12 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 4 |
Parental | IVLLSIP-FFSVPVAWTLTNIIHNLGMYVFLHA-VKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFF |
IVLLSIP.FF.V..A.TLTNII.NLGM....HA..KG.P.ETPDQGKARLLTH.EQL..GV.FTSSRKFF | |
Retrocopy | IVLLSIP<FFCVLIA*TLTNIIRNLGMNGCFHA<LKGMPLETPDQGKARLLTH*EQLGEGVPFTSSRKFF |
Parental | TISPIILYFLASFYT-KYDPTHFILNTASLLSVL-IPKMPQLHGVRIFGINK |
TISPIIL.F.ASFY..KY.PTH.I..TASLLS.L..P.MPQ.HG..IFGINK | |
Retrocopy | TISPIILHFPASFYR<KYAPTHSIVSTASLLSTL>TPQMPQRHGAPIFGINK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .22 RPM | 21 .40 RPM |
SRP007412_brain_prefrontal_cortex | 0 .24 RPM | 16 .58 RPM |
SRP007412_cerebellum | 0 .00 RPM | 27 .38 RPM |
SRP007412_heart | 0 .00 RPM | 11 .54 RPM |
SRP007412_kidney | 0 .00 RPM | 15 .96 RPM |
SRP007412_liver | 0 .00 RPM | 9 .26 RPM |
SRP007412_testis | 0 .00 RPM | 18 .58 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_645 |
Pan troglodytes | retro_ptro_469 |
Gorilla gorilla | retro_ggor_565 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000005579 | 1 retrocopy | |
Homo sapiens | ENSG00000128699 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000015259 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000007769 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000014339 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006292 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000014316 | 1 retrocopy |
retro_mmul_2432 ,
|
Nomascus leucogenys | ENSNLEG00000006625 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000013017 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000012736 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000016044 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000012942 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005240 | 2 retrocopies |