RetrogeneDB ID: | retro_cjac_2990 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 7:75121744..75122369(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GTF2F2 | ||
| Ensembl ID: | ENSCJAG00000019220 | ||
| Aliases: | None | ||
| Description: | general transcription factor IIF, polypeptide 2, 30kDa [Source:HGNC Symbol;Acc:4653] |
| Percent Identity: | 58.14 % |
| Parental protein coverage: | 84.74 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | ELDLTGAKQNTG-VWLVKVPKYLSQQWAKAPGRGEVGKLRIAKNQGRTEVSFTLNEDLANIHDIGGKPAS |
| .L.L....QN....WLV.VPKYLS..W..A.G..EVGKL..AKNQ.....SFTLNEDL.NIHDI.G.P.. | |
| Retrocopy | QLNLEAIQQNSC<LWLVEVPKYLS*EWSEASGSSEVGKLQTAKNQRKSALSFTLNEDLKNIHDIDGQPTQ |
| Parental | -VSAPREHP-FVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLS |
| .VS.PRE.P.F......G....V.TE....KLSLEG..VQR.EC.PA...N.MR.KR.Q........... | |
| Retrocopy | <VSTPREAP>FLCRGSEGRS-SVLTERAPSKLSLEG-TVQRGECQPATN*NSMRRKRMQTQXXXXXXXTL |
| Parental | QQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPV-V |
| Q.LDKVVT..YKPVANHQYN..YE.KKKE.GKR..ADK..VL..LF.AFEKHQYYN.KD.V.IT.QPV.V | |
| Retrocopy | QTLDKVVTAGYKPVANHQYNTAYEKKKKEEGKRVQADKDQVLFLLFAAFEKHQYYNIKDTVGITVQPV<V |
| Parental | YLKEI |
| .LKEI | |
| Retrocopy | CLKEI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 10 .45 RPM |
| SRP051959_heart | 0 .00 RPM | 7 .21 RPM |
| SRP051959_kidney | 0 .00 RPM | 7 .92 RPM |
| SRP051959_liver | 0 .00 RPM | 8 .92 RPM |
| SRP051959_lung | 0 .00 RPM | 9 .21 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 13 .99 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 13 .95 RPM |
| SRP051959_spleen | 0 .11 RPM | 12 .84 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_368 |
| Pan troglodytes | retro_ptro_288 |
| Gorilla gorilla | retro_ggor_379 |
| Macaca mulatta | retro_mmul_483 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000028333 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007391 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019220 | 2 retrocopies |
retro_cjac_1351, retro_cjac_2990 ,
|
| Homo sapiens | ENSG00000188342 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000006657 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010505 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012634 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000025484 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002097 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002106 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012517 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000005868 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000005333 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005840 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000029316 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000006891 | 1 retrocopy |