RetrogeneDB ID: | retro_cjac_3233 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 9:82650005..82650403(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TM2D3 | ||
| Ensembl ID: | ENSCJAG00000017340 | ||
| Aliases: | None | ||
| Description: | TM2 domain containing 3 [Source:HGNC Symbol;Acc:24128] |
| Percent Identity: | 69.34 % |
| Parental protein coverage: | 55.06 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | DFKSQKNFIINMTCRFCWQLPETDYECS-NSTSCMTVACPRQRYTANCTVRDHVHCLGNRTFPKMLYCNW |
| ..KSQ.NFIIN.TCRFCW.LP...YECS.NSTS.M...CP...YTANCT...........TF.K.LY.NW | |
| Retrocopy | ELKSQSNFIINTTCRFCWKLPKPEYECS<NSTSSMR-SCPQWHYTANCTINTFMTWV--TTFYKTLY*NW |
| Parental | TGGYKWSTALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI |
| ..GYKWS.ALALSITLGGFGAD.FY..QW.EGLGKLFSF..LGIWTLID.LLIGVGY.GPADGS.YI | |
| Retrocopy | AAGYKWSIALALSITLGGFGADHFYQDQWQEGLGKLFSFSCLGIWTLIDILLIGVGYIGPADGS*YI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 6 .81 RPM |
| SRP051959_heart | 0 .00 RPM | 10 .47 RPM |
| SRP051959_kidney | 0 .00 RPM | 11 .69 RPM |
| SRP051959_liver | 0 .00 RPM | 8 .69 RPM |
| SRP051959_lung | 0 .00 RPM | 8 .91 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 10 .41 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 8 .04 RPM |
| SRP051959_spleen | 0 .00 RPM | 10 .34 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000017340 | 1 retrocopy |
retro_cjac_3233 ,
|
| Homo sapiens | ENSG00000184277 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011598 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000277 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010985 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000529 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007515 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000004536 | 1 retrocopy |