RetrogeneDB ID: | retro_cpor_1358 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_71:4741602..4741919(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF3J | ||
| Ensembl ID: | ENSCPOG00000012396 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.96 % |
| Parental protein coverage: | 66.25 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | RDDFTEFGKLLKDKITQYEKSLYYASFLEALVR-DVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKK |
| .D....F.KLLK.KI.QY.KSLYYASFLE.....DVCI.L..DDLKKITNSL.VLC..KQK..KQSK.KK | |
| Retrocopy | QDMISQFVKLLKNKIRQYKKSLYYASFLEGSYE<DVCI*LKTDDLKKITNSLSVLCCWKQK*AKQSKTKK |
| Parental | KKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM |
| .KKGVVPGG.LKATMKD.LADYGGY..GY.QD.EDFM | |
| Retrocopy | EKKGVVPGGTLKATMKDSLADYGGYHEGYAQDHEDFM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 27 .32 RPM |
| SRP017611_kidney | 0 .00 RPM | 34 .65 RPM |
| SRP017611_liver | 0 .00 RPM | 31 .03 RPM |
| SRP040447_lung | 0 .00 RPM | 21 .97 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 36 .76 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002412 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012396 | 3 retrocopies |
retro_cpor_1357, retro_cpor_1358 , retro_cpor_500,
|
| Gorilla gorilla | ENSGGOG00000000548 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000010372 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017696 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000027236 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005568 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005376 | 1 retrocopy |