RetrogeneDB ID: | retro_cpor_751 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_26:25870656..25871078(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2V2 | ||
Ensembl ID: | ENSCPOG00000014413 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 67.12 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MFFCIGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDE-DMTLTRWTGMIIGPPRTNYENRIYSLKVEC |
M....GVKVP..F.L.EEL.E.QKGVGDG.V..GLEDDE.....TRW.GMIIGP.RTNYENR.YSLKVE. | |
Retrocopy | MVVSTGVKVPGHFCLWEELKERQKGVGDGMVRLGLEDDE<NRAFTRWIGMIIGPSRTNYENRLYSLKVEG |
Parental | GPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPE |
..K..EAPPSV.F.TKIN.NGI.NSS.MVD..SIPVLAKWQ.S.SIKVVL.ELR.LMMS..N....Q... | |
Retrocopy | ASKQSEAPPSVSFITKINVNGISNSSRMVDVCSIPVLAKWQDSNSIKVVLEELRYLMMSRKN----QQKA |
Parental | GQTYNN |
..TYNN | |
Retrocopy | KHTYNN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 19 .10 RPM |
SRP017611_kidney | 0 .00 RPM | 11 .20 RPM |
SRP017611_liver | 0 .00 RPM | 9 .14 RPM |
SRP040447_lung | 0 .00 RPM | 12 .36 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 9 .73 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000028827 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000014413 | 4 retrocopies | |
Felis catus | ENSFCAG00000007602 | 6 retrocopies | |
Macropus eugenii | ENSMEUG00000016581 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000002057 | 6 retrocopies | |
Macaca mulatta | ENSMMUG00000008223 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000010191 | 10 retrocopies | |
Mustela putorius furo | ENSMPUG00000001010 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006933 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015720 | 27 retrocopies |
retro_tbel_1333, retro_tbel_1456, retro_tbel_1479, retro_tbel_1551, retro_tbel_160, retro_tbel_1740, retro_tbel_1784, retro_tbel_2129, retro_tbel_2149, retro_tbel_2317, retro_tbel_2334, retro_tbel_2496, retro_tbel_2890, retro_tbel_2935, retro_tbel_3021, retro_tbel_3102, retro_tbel_3141, retro_tbel_3461, retro_tbel_3573, retro_tbel_3734, retro_tbel_3935, retro_tbel_3971, retro_tbel_4227, retro_tbel_4319, retro_tbel_4720, retro_tbel_640, retro_tbel_909,
|