RetrogeneDB ID: | retro_cpor_842 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_3:74285509..74285799(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H3F3B | ||
| Ensembl ID: | ENSCPOG00000004707 | ||
| Aliases: | None | ||
| Description: | Histone H3 [Source:UniProtKB/TrEMBL;Acc:H0V3S0] |
| Percent Identity: | 53.06 % |
| Parental protein coverage: | 70.59 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELL-IRKLPFQRLVREIAQDFK-TDLRFQSAAIGALQE |
| K.APSTGGVKK.HRYRPGTV.LR.....Q.ST.....R......L........K..D..FQ.A....L.E | |
| Retrocopy | KRAPSTGGVKKLHRYRPGTVPLRGAGHHQESTDVHGVRSVLSRVLCKKLLRTTK<ADPHFQGAVADSLRE |
| Parental | ASEAYLVGLFEDTNLCAIHAKRVTIMPK |
| ASEA.L.GLFED.NLC...AKRVT.M.K | |
| Retrocopy | ASEASLPGLFEDPNLCSVLAKRVTVMLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 67 .75 RPM |
| SRP017611_kidney | 0 .00 RPM | 163 .52 RPM |
| SRP017611_liver | 0 .04 RPM | 79 .74 RPM |
| SRP040447_lung | 0 .00 RPM | 205 .10 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 127 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009765 | 3 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000009661 | 10 retrocopies | |
| Cavia porcellus | ENSCPOG00000004707 | 7 retrocopies |
retro_cpor_1059, retro_cpor_1390, retro_cpor_1524, retro_cpor_432, retro_cpor_695, retro_cpor_842 , retro_cpor_853,
|
| Loxodonta africana | ENSLAFG00000021624 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000015447 | 10 retrocopies | |
| Mus musculus | ENSMUSG00000060743 | 19 retrocopies |
retro_mmus_1053, retro_mmus_1116, retro_mmus_1139, retro_mmus_1151, retro_mmus_1254, retro_mmus_2285, retro_mmus_2614, retro_mmus_2934, retro_mmus_3009, retro_mmus_3213, retro_mmus_3425, retro_mmus_395, retro_mmus_498, retro_mmus_808, retro_mmus_884, retro_mmus_885, retro_mmus_886, retro_mmus_959, retro_mmus_960,
|
| Oryctolagus cuniculus | ENSOCUG00000024644 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008636 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000024226 | 8 retrocopies | |
| Tupaia belangeri | ENSTBEG00000006177 | 13 retrocopies |