RetrogeneDB ID: | retro_dnov_1109 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_148317:3905..4217(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UQCRB | ||
Ensembl ID: | ENSDNOG00000017312 | ||
Aliases: | None | ||
Description: | ubiquinol-cytochrome c reductase binding protein [Source:HGNC Symbol;Acc:12582] |
Percent Identity: | 78.85 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ASSGQWLDSIQKQYHRVVEGREKGLMRDDT-YENEDVKEAIKRLPENVYNDRMFRIKRALDLTMKHQILP |
A.SG.WLD.I.K.Y.........GLMRDDT.Y.NEDVKEAIKRLP.N.YNDRMFRIKRALDLTMKHQILP | |
Retrocopy | AASGRWLDGIRKWYYNAAGFNKLGLMRDDTIYKNEDVKEAIKRLPKNLYNDRMFRIKRALDLTMKHQILP |
Parental | KEQWTKYEEDKFYLEPYLKEVIREIKEREEWAKK |
.EQWT.YEEDKFYLEPYLKEVI.E.KEREEWAKK | |
Retrocopy | TEQWTRYEEDKFYLEPYLKEVIQERKEREEWAKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 71 .95 RPM | 50 .95 RPM |
SRP012922_cerebellum | 23 .92 RPM | 14 .30 RPM |
SRP012922_heart | 143 .16 RPM | 91 .19 RPM |
SRP012922_kidney | 51 .75 RPM | 31 .76 RPM |
SRP012922_liver | 31 .43 RPM | 24 .15 RPM |
SRP012922_lung | 29 .78 RPM | 17 .87 RPM |
SRP012922_quadricep_muscle | 106 .45 RPM | 60 .58 RPM |
SRP012922_spleen | 24 .84 RPM | 17 .51 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000009449 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000017312 | 8 retrocopies |
retro_dnov_1109 , retro_dnov_1163, retro_dnov_1706, retro_dnov_2410, retro_dnov_2518, retro_dnov_369, retro_dnov_608, retro_dnov_798,
|
Latimeria chalumnae | ENSLACG00000004465 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000007182 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000026670 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000008892 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000024967 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008017 | 1 retrocopy | |
Drosophila melanogaster | FBgn0030733 | 1 retrocopy |