RetrogeneDB ID: | retro_dnov_2518 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_8199:53835..54132(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UQCRB | ||
| Ensembl ID: | ENSDNOG00000017312 | ||
| Aliases: | None | ||
| Description: | ubiquinol-cytochrome c reductase binding protein [Source:HGNC Symbol;Acc:12582] |
Retrocopy-Parental alignment summary:
>retro_dnov_2518
GCAGCATCAGGCCAATGGCTGGATGGTATTTGAAAATAGTATTACAATGCTACAGGATTCAATAAACTAGGGTTAATGCG
AGATGATACAATAGCCGAGAATGAAGATGTAAAAGAAGCCATAAGAAGGCTTCCCGAGAACCTTTACAATGACAGGATGT
TTCACATTAGGAGAGCACTGGACTTGACCATGAAGCATCAGATCTTGCCTACAGAGCAGTGGACAAAATACAAGTCCAAT
AAATTCTACCTTGAACCATATCTGAAAGAAGTTATTCGGGAAAGAAAAGAAAGAGAA
ORF - retro_dnov_2518 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 75.76 % |
| Parental protein coverage: | 95.15 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | ASSGQWLDSIQKQYHRVVEGREKGLMRDDTY-ENEDVKEAIKRLPENVYNDRMFRIKRALDLTMKHQILP |
| A.SGQWLD.I.K.Y.........GLMRDDT..ENEDVKEAI.RLPEN.YNDRMF.I.RALDLTMKHQILP | |
| Retrocopy | AASGQWLDGI*K*YYNATGFNKLGLMRDDTIAENEDVKEAIRRLPENLYNDRMFHIRRALDLTMKHQILP |
| Parental | KEQWTKYEEDKFYLEPYLKEVIREIKERE |
| .EQWTKY...KFYLEPYLKEVIRE.KERE | |
| Retrocopy | TEQWTKYKSNKFYLEPYLKEVIRERKERE |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .58 RPM | 50 .95 RPM |
| SRP012922_cerebellum | 0 .27 RPM | 14 .30 RPM |
| SRP012922_heart | 2 .09 RPM | 91 .19 RPM |
| SRP012922_kidney | 0 .27 RPM | 31 .76 RPM |
| SRP012922_liver | 0 .31 RPM | 24 .15 RPM |
| SRP012922_lung | 0 .15 RPM | 17 .87 RPM |
| SRP012922_quadricep_muscle | 1 .38 RPM | 60 .58 RPM |
| SRP012922_spleen | 0 .23 RPM | 17 .51 RPM |
Dasypus novemcinctus was not studied using ChIP-Seq data.
Dasypus novemcinctus was not studied using EST data.
Dasypus novemcinctus was not studied using FANTOM5 data.
retro_dnov_2518 was not experimentally validated.
Retrocopy orthology:
Dasypus novemcinctus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 9 parental genes, and 20 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000009449 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000017312 | 8 retrocopies |
retro_dnov_1109, retro_dnov_1163, retro_dnov_1706, retro_dnov_2410, retro_dnov_2518 , retro_dnov_369, retro_dnov_608, retro_dnov_798,
|
| Latimeria chalumnae | ENSLACG00000004465 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007182 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000026670 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000008892 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000024967 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000008017 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0030733 | 1 retrocopy |