RetrogeneDB ID: | retro_dnov_1416 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_20037:20276..20470(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SERP1 | ||
Ensembl ID: | ENSDNOG00000013995 | ||
Aliases: | None | ||
Description: | stress-associated endoplasmic reticulum protein 1 [Source:HGNC Symbol;Acc:10759] |
Percent Identity: | 71.64 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MVAKQ-RIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM |
MVAK..RIR.A..K.SKN.TQRG.VAKTSRNA.EEKASVG.W.L.LFIF.VC.S.IF.I..SIRM.M | |
Retrocopy | MVAKP<RIRTAKDKQSKNVTQRGHVAKTSRNALEEKASVGSW*LTLFIF-VCASTIFHIT*SIRMSM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 43 .76 RPM |
SRP012922_cerebellum | 0 .00 RPM | 11 .96 RPM |
SRP012922_heart | 0 .00 RPM | 2 .78 RPM |
SRP012922_kidney | 0 .00 RPM | 18 .62 RPM |
SRP012922_liver | 0 .00 RPM | 33 .28 RPM |
SRP012922_lung | 0 .00 RPM | 49 .18 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 1 .21 RPM |
SRP012922_spleen | 0 .00 RPM | 55 .06 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000013995 | 15 retrocopies | |
Microcebus murinus | ENSMICG00000000414 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000016085 | 2 retrocopies |