RetrogeneDB ID: | retro_ocun_1835 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | GL019195:6918..7094(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SERP1 | ||
Ensembl ID: | ENSOCUG00000016085 | ||
Aliases: | None | ||
Description: | stress-associated endoplasmic reticulum protein 1 [Source:HGNC Symbol;Acc:10759] |
Percent Identity: | 52.46 % |
Parental protein coverage: | 90.91 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | IRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ-SIRMGM |
I.M..EKHSKN........KTS.N...EK.SVG....AL..F.VC..A..QIIQ.SI.MGM | |
Retrocopy | IPMVKEKHSKNVIRGSSFSKTSKNELKEKESVGLVIGALH-FLVCCCATLQIIQ<SILMGM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 11 .53 RPM |
SRP017611_kidney | 0 .00 RPM | 27 .67 RPM |
SRP017611_liver | 0 .00 RPM | 12 .87 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000013995 | 15 retrocopies | |
Microcebus murinus | ENSMICG00000000414 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000016085 | 2 retrocopies |
retro_ocun_1542, retro_ocun_1835 ,
|