RetrogeneDB ID: | retro_dnov_1512 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_221465:52..402(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C16orf87 | ||
Ensembl ID: | ENSDNOG00000006412 | ||
Aliases: | None | ||
Description: | chromosome 16 open reading frame 87 [Source:HGNC Symbol;Acc:33754] |
Percent Identity: | 77.12 % |
Parental protein coverage: | 75.97 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | SRKLLNARHSEKSPPSTENKHEAKRRRTERVRREKINSTVNKDLEN-RKRSRSNSHSDHIRRGRGRPKSA |
.RKLLNA.HSEKS.PSTENK.EAKR...ERVR.EK.NSTVNKDLE..RKRS.SNSHSDHIR.GR.RPK.A | |
Retrocopy | NRKLLNAKHSEKSQPSTENKCEAKRSQMERVRQEKLNSTVNKDLEK<RKRSQSNSHSDHIR*GRERPKGA |
Parental | SAKKHEEEREKQEKEIDIYANLSDEKAFVFSVALAEINRKIINQRLIL |
.A..HEEE.EK.EKEID.YANL.D.KA.VFSV.L.E.NRKIINQRLIL | |
Retrocopy | FANRHEEEIEKEEKEIDTYANLTDKKALVFSVTLVEKNRKIINQRLIL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 2 .92 RPM |
SRP012922_cerebellum | 0 .00 RPM | 8 .94 RPM |
SRP012922_heart | 0 .00 RPM | 3 .71 RPM |
SRP012922_kidney | 0 .00 RPM | 2 .46 RPM |
SRP012922_liver | 0 .00 RPM | 2 .32 RPM |
SRP012922_lung | 0 .00 RPM | 7 .03 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 1 .73 RPM |
SRP012922_spleen | 0 .00 RPM | 5 .72 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000003679 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000010228 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000006412 | 2 retrocopies |
retro_dnov_1512 , retro_dnov_2463,
|
Tupaia belangeri | ENSTBEG00000013316 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000008921 | 1 retrocopy |