RetrogeneDB ID: | retro_dnov_1529 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_227339:1083..1392(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SMIM20 | ||
| Ensembl ID: | ENSDNOG00000004966 | ||
| Aliases: | None | ||
| Description: | small integral membrane protein 20 [Source:HGNC Symbol;Acc:37260] |
| Percent Identity: | 66.02 % |
| Parental protein coverage: | 97.03 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | ESCPSSSQPGHGISDSGR----EGCLAGQGCPPGA-MSRNLRTALVFGGFISLLGAVFYPIYFRPLLRLE |
| ESC.SSS..G.G..D..R....EGCL.GQ..PP...MS.NL.T...F..FISLL..VFYP.YF..L..LE | |
| Retrocopy | ESCSSSSEAGQGWADGSRDFENEGCLQGQSWPPASTMSCNLATMHIFHSFISLLSIVFYPFYFLLLMQLE |
| Parental | EYQKEQAINRAGIVQADVQPPGLKVWSDPFGRK |
| EYQKEQAINRAGIVQADVQ.PGLK..SDPFGRK | |
| Retrocopy | EYQKEQAINRAGIVQADVQCPGLKIQSDPFGRK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 19 .06 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 12 .65 RPM |
| SRP012922_heart | 0 .00 RPM | 34 .80 RPM |
| SRP012922_kidney | 0 .00 RPM | 33 .95 RPM |
| SRP012922_liver | 0 .00 RPM | 19 .51 RPM |
| SRP012922_lung | 0 .00 RPM | 16 .95 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 37 .91 RPM |
| SRP012922_spleen | 0 .00 RPM | 22 .89 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003897 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004966 | 2 retrocopies |
retro_dnov_1474, retro_dnov_1529 ,
|
| Macropus eugenii | ENSMEUG00000002680 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000017222 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006680 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016894 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000004810 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000015052 | 2 retrocopies |