RetrogeneDB ID: | retro_itri_699 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393312.1:4350194..4350387(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SMIM20 | ||
Ensembl ID: | ENSSTOG00000004810 | ||
Aliases: | None | ||
Description: | small integral membrane protein 20 [Source:HGNC Symbol;Acc:37260] |
Percent Identity: | 68.66 % |
Parental protein coverage: | 95.59 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | RNLRTALIFGGFVSLVG-AAFYPIYFRPLMRLEEYQKEQAINRAGIVQEDVQP-PGLKVWSDPFGRK |
.NL.T.LIFG..VSL.G.AAFY.IYF..LMRLEEYQK.Q.IN.A.IVQ.DVQP..GL..WS.PF.RK | |
Retrocopy | QNLHTLLIFGCLVSLLG<AAFYCIYFCLLMRLEEYQKKQVINQANIVQ*DVQP<TGLRMWSYPFSRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003897 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004966 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000002680 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000017222 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006680 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016894 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000004810 | 1 retrocopy |
retro_itri_699 ,
|
Tupaia belangeri | ENSTBEG00000015052 | 2 retrocopies |