RetrogeneDB ID: | retro_meug_147 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | GeneScaffold_4313:69272..69501(+) | ||
Located in intron of: | ENSMEUG00000005388 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SMIM20 | ||
Ensembl ID: | ENSMEUG00000002680 | ||
Aliases: | None | ||
Description: | small integral membrane protein 20 [Source:HGNC Symbol;Acc:37260] |
Percent Identity: | 57.14 % |
Parental protein coverage: | 75.76 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | VLPDLPSS-VMSRNLRTTMIFGGFALLLGAAFYPIYFRPLMRTEEYKVEQAMNDR-IVQADMQPPGLKVW |
..P..PS..V.S..L.T..IF...A.LLGA.FY.I.F.PLM.T.EYK...A.N...I.Q.D.QPPGL.VW | |
Retrocopy | LVPHIPSL>VTSHKLHTMIIFSSLAFLLGATFYLICFWPLMKTKEYKL**AINQADIIQTDVQPPGLTVW |
Parental | SDPFGRK |
SDPFGRK | |
Retrocopy | SDPFGRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003897 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004966 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000002680 | 1 retrocopy |
retro_meug_147 ,
|
Microcebus murinus | ENSMICG00000017222 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006680 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016894 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000004810 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015052 | 2 retrocopies |