RetrogeneDB ID: | retro_dnov_1669 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_261096:717..1019(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CNIH4 | ||
Ensembl ID: | ENSDNOG00000007093 | ||
Aliases: | None | ||
Description: | cornichon homolog 4 (Drosophila) [Source:HGNC Symbol;Acc:25013] |
Percent Identity: | 81.55 % |
Parental protein coverage: | 94.39 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | IITLSDLECDYINARSCCSKLNKWVIPELIGHTFVTVLMLISLHWFIFLLNLPVATWN-IYRFIMVPSGN |
IITL.DLECDYIN.RSCCSKLNKW.IPELIGHT.VTVL.LISLHWFIFLL.L.VATW..IYRF.MVPSGN | |
Retrocopy | IITLCDLECDYINTRSCCSKLNKWAIPELIGHTIVTVLKLISLHWFIFLLDLSVATWK>IYRFLMVPSGN |
Parental | MGVFDPTEIHN-RGQLKSHMKEAMIKLGFHLLC |
MGVFDP.E..N..G...SHMKEA.IKLGFHLLC | |
Retrocopy | MGVFDPPETQN>KGK-SSHMKEAIIKLGFHLLC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 7 .78 RPM |
SRP012922_cerebellum | 0 .00 RPM | 2 .06 RPM |
SRP012922_heart | 0 .00 RPM | 2 .78 RPM |
SRP012922_kidney | 0 .00 RPM | 7 .12 RPM |
SRP012922_liver | 0 .00 RPM | 9 .29 RPM |
SRP012922_lung | 0 .00 RPM | 9 .01 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 4 .67 RPM |
SRP012922_spleen | 0 .00 RPM | 7 .67 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000006544 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000008013 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000007310 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007093 | 1 retrocopy |
retro_dnov_1669 ,
|
Homo sapiens | ENSG00000143771 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000005708 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003134 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000009936 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013549 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000001589 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000183 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000002025 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000014034 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000027396 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000012521 | 2 retrocopies |