RetrogeneDB ID: | retro_dnov_1669 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_261096:717..1019(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CNIH4 | ||
| Ensembl ID: | ENSDNOG00000007093 | ||
| Aliases: | None | ||
| Description: | cornichon homolog 4 (Drosophila) [Source:HGNC Symbol;Acc:25013] |
| Percent Identity: | 81.55 % |
| Parental protein coverage: | 94.39 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | IITLSDLECDYINARSCCSKLNKWVIPELIGHTFVTVLMLISLHWFIFLLNLPVATWN-IYRFIMVPSGN |
| IITL.DLECDYIN.RSCCSKLNKW.IPELIGHT.VTVL.LISLHWFIFLL.L.VATW..IYRF.MVPSGN | |
| Retrocopy | IITLCDLECDYINTRSCCSKLNKWAIPELIGHTIVTVLKLISLHWFIFLLDLSVATWK>IYRFLMVPSGN |
| Parental | MGVFDPTEIHN-RGQLKSHMKEAMIKLGFHLLC |
| MGVFDP.E..N..G...SHMKEA.IKLGFHLLC | |
| Retrocopy | MGVFDPPETQN>KGK-SSHMKEAIIKLGFHLLC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 7 .78 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 2 .06 RPM |
| SRP012922_heart | 0 .00 RPM | 2 .78 RPM |
| SRP012922_kidney | 0 .00 RPM | 7 .12 RPM |
| SRP012922_liver | 0 .00 RPM | 9 .29 RPM |
| SRP012922_lung | 0 .00 RPM | 9 .01 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 4 .67 RPM |
| SRP012922_spleen | 0 .00 RPM | 7 .67 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006544 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000008013 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000007310 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007093 | 1 retrocopy |
retro_dnov_1669 ,
|
| Homo sapiens | ENSG00000143771 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000005708 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003134 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009936 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013549 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000001589 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000183 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000002025 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000014034 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027396 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000012521 | 2 retrocopies |