RetrogeneDB ID: | retro_ptro_2481 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 6:128693485..128693815(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CNIH4 | ||
Ensembl ID: | ENSPTRG00000002025 | ||
Aliases: | None | ||
Description: | cornichon homolog 4 (Drosophila) [Source:HGNC Symbol;Acc:25013] |
Percent Identity: | 78.95 % |
Parental protein coverage: | 80.58 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | EAVVFVLSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVI-PELIGHTIVTV-LLLISLHWF |
E..VFV..LL.C..LIFLS..FIITLSDLECDYINARSCCSKLNKWVI.P.LIGHTIVTV..L.I.LHWF | |
Retrocopy | EDMVFVFFLLSC-RLIFLSL-FIITLSDLECDYINARSCCSKLNKWVI>PRLIGHTIVTV<ILHILLHWF |
Parental | IFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKE |
IFLLNLP.ATWNIY..IMVPS.N.GVFDPTEIHN.GQ.K.HMK. | |
Retrocopy | IFLLNLPLATWNIY*FIMVPSSNIGVFDPTEIHNQGQQK*HMKD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 5 .15 RPM |
SRP007412_cerebellum | 0 .00 RPM | 10 .40 RPM |
SRP007412_heart | 0 .03 RPM | 10 .96 RPM |
SRP007412_kidney | 0 .00 RPM | 17 .89 RPM |
SRP007412_liver | 0 .00 RPM | 17 .77 RPM |
SRP007412_testis | 0 .11 RPM | 16 .33 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3656 |
Pongo abelii | retro_pabe_3003 |
Macaca mulatta | retro_mmul_1796 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000006544 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000008013 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000007310 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007093 | 1 retrocopy | |
Homo sapiens | ENSG00000143771 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000005708 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003134 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000009936 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013549 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000001589 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000183 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000002025 | 1 retrocopy |
retro_ptro_2481 ,
|
Pteropus vampyrus | ENSPVAG00000014034 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000027396 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000012521 | 2 retrocopies |