RetrogeneDB ID: | retro_dnov_190 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_2465:156447..156631(+) | ||
Located in intron of: | ENSDNOG00000006049 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPL33 | ||
Ensembl ID: | ENSDNOG00000015881 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein L33 [Source:HGNC Symbol;Acc:14487] |
Percent Identity: | 76.56 % |
Parental protein coverage: | 95.38 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MFLSAVSL-AKSKSKTILVKMISQAG-TGYTFNTKRSRLQEKLTLLHYDPVVNKKVLFVEKKKI |
MFLS.VS..AK.KSKTILVKMISQA...GYTFNTKRS.L.E.LTLLHY.PV.N.KVL.V.KKKI | |
Retrocopy | MFLSKVSM<AKNKSKTILVKMISQAR<VGYTFNTKRSQL*EILTLLHYKPVLN*KVLLVGKKKI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 20 .42 RPM |
SRP012922_cerebellum | 0 .00 RPM | 19 .80 RPM |
SRP012922_heart | 0 .00 RPM | 43 .85 RPM |
SRP012922_kidney | 0 .00 RPM | 21 .90 RPM |
SRP012922_liver | 0 .00 RPM | 25 .85 RPM |
SRP012922_lung | 0 .15 RPM | 33 .45 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 27 .00 RPM |
SRP012922_spleen | 0 .00 RPM | 27 .01 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000015881 | 1 retrocopy |
retro_dnov_190 ,
|
Echinops telfairi | ENSETEG00000003239 | 2 retrocopies | |
Mus musculus | ENSMUSG00000029142 | 2 retrocopies |