RetrogeneDB ID: | retro_dnov_190 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_2465:156447..156631(+) | ||
| Located in intron of: | ENSDNOG00000006049 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPL33 | ||
| Ensembl ID: | ENSDNOG00000015881 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L33 [Source:HGNC Symbol;Acc:14487] |
Retrocopy-Parental alignment summary:
>retro_dnov_190
ATGTTCCTAAGCAAGGTCTCCATGCCAAGAACAAGTCAAAAACCATTCTGGTGAAAATGATAAGCCAAGCTAGGTAGGTT
ACACCTTTAACACCAAGAGAAGCCAACTATGAGAGATACTGACTCTTTTGCATTATAAGCCTGTGCTGAACTAAAAAGTC
CTCCTTGTGGGAAAGAAAAAAATA
ORF - retro_dnov_190 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 76.56 % |
| Parental protein coverage: | 95.38 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
Retrocopy - Parental Gene Alignment:
| Parental | MFLSAVSL-AKSKSKTILVKMISQAG-TGYTFNTKRSRLQEKLTLLHYDPVVNKKVLFVEKKKI |
| MFLS.VS..AK.KSKTILVKMISQA...GYTFNTKRS.L.E.LTLLHY.PV.N.KVL.V.KKKI | |
| Retrocopy | MFLSKVSM<AKNKSKTILVKMISQAR<VGYTFNTKRSQL*EILTLLHYKPVLN*KVLLVGKKKI |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 20 .42 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 19 .80 RPM |
| SRP012922_heart | 0 .00 RPM | 43 .85 RPM |
| SRP012922_kidney | 0 .00 RPM | 21 .90 RPM |
| SRP012922_liver | 0 .00 RPM | 25 .85 RPM |
| SRP012922_lung | 0 .15 RPM | 33 .45 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 27 .00 RPM |
| SRP012922_spleen | 0 .00 RPM | 27 .01 RPM |
Dasypus novemcinctus was not studied using ChIP-Seq data.
Dasypus novemcinctus was not studied using EST data.
Dasypus novemcinctus was not studied using FANTOM5 data.
retro_dnov_190 was not experimentally validated.
Retrocopy orthology:
Dasypus novemcinctus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 3 parental genes, and 5 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000015881 | 1 retrocopy |
retro_dnov_190 ,
|
| Echinops telfairi | ENSETEG00000003239 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000029142 | 2 retrocopies |