RetrogeneDB ID: | retro_etel_2106 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_61812:516..697(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPL33 | ||
Ensembl ID: | ENSETEG00000003239 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein L33 [Source:HGNC Symbol;Acc:14487] |
Percent Identity: | 50.82 % |
Parental protein coverage: | 92.31 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | FLTAVSFARSKSKNILV-KMLSQAGTGYTFNTKRSRLREKLTLLRYDPVVQKKVLFVEQKK |
FL...S.A.S.....LV.K..SQAGTG.TFNTKR..L..K.TLL.Y....Q...LF.E..K | |
Retrocopy | FLPTISSAKSNASKQLV>KIMSQAGTG*TFNTKRQQL*QKQTLLQYSNDEQNIFLFCETGK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000015881 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000003239 | 2 retrocopies |
retro_etel_2106 , retro_etel_322,
|
Mus musculus | ENSMUSG00000029142 | 2 retrocopies |