RetrogeneDB ID: | retro_dnov_2045 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_44355:4574..4799(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPA3 | ||
Ensembl ID: | ENSDNOG00000011718 | ||
Aliases: | None | ||
Description: | replication protein A3, 14kDa [Source:HGNC Symbol;Acc:10291] |
Percent Identity: | 89.33 % |
Parental protein coverage: | 79.79 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MVDVMELPKWRINASMLAQFIDRPVCFVGRLEKIHPTEKMFILSDGEGKNGTIELMEPLDEEISGIVEVV |
MV.VMEL.KWRIN.SMLAQFIDRPVCFVGRLEKIHPT.KMFILSDGEGKNGTIELMEPLDEEISGIVEVV | |
Retrocopy | MVNVMELLKWRINTSMLAQFIDRPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVV |
Parental | GRVTN |
....N | |
Retrocopy | DEQGN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 2 .33 RPM | 7 .58 RPM |
SRP012922_cerebellum | 2 .06 RPM | 8 .66 RPM |
SRP012922_heart | 1 .86 RPM | 3 .71 RPM |
SRP012922_kidney | 2 .74 RPM | 6 .84 RPM |
SRP012922_liver | 0 .93 RPM | 3 .87 RPM |
SRP012922_lung | 3 .36 RPM | 9 .77 RPM |
SRP012922_quadricep_muscle | 1 .73 RPM | 4 .67 RPM |
SRP012922_spleen | 3 .43 RPM | 12 .25 RPM |