RetrogeneDB ID: | retro_cpor_855 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_3:36321413..36321637(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCPOG00000011748 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 66.67 % |
Parental protein coverage: | 64.1 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | TGKMFILSDGEGK-NGTVELMEPLD-EEISGIVEVVGRVTAKATIMCSSYVQFREDNN-PFDLGLYNEAV |
TG....LSDGEGK.N.T.ELM.P...E.ISGI.EVVGR.TAK..IMC..Y.QFREDNN..F.L.LYN.AV | |
Retrocopy | TG*TLVLSDGEGK>NRTSELMKPFE<EIISGIMEVVGRITAKVIIMCVFYLQFREDNN<SFYLRLYNVAV |
Parental | KIIHEFPQ |
.II.EFPQ | |
Retrocopy | EIIYEFPQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 4 .43 RPM |
SRP017611_kidney | 0 .00 RPM | 5 .97 RPM |
SRP017611_liver | 0 .00 RPM | 8 .62 RPM |
SRP040447_lung | 0 .00 RPM | 9 .21 RPM |
SRP040447_skeletal_muscle | 0 .12 RPM | 4 .10 RPM |