RetrogeneDB ID: | retro_dnov_215 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_2697:14565..14811(+) | ||
Located in intron of: | ENSDNOG00000004841 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2A | ||
Ensembl ID: | ENSDNOG00000007060 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2A [Source:HGNC Symbol;Acc:12472] |
Percent Identity: | 67.07 % |
Parental protein coverage: | 53.64 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | SENNIMVWNAVIFGXXXXXXXXXTFKLTIEFTEEYPNKPPTVRFVSKMF-PNVYADGSICLDILQNRWSP |
S.NNIM.WNA.IFG.........T.K..IEF.EEYP.K..TVRF.SKM..PNVYAD..IC.DILQNRWSP | |
Retrocopy | SANNIMQWNAFIFGPEGTPFEDGTLKFIIEFSEEYPDKLSTVRFLSKMLHPNVYADDTIC*DILQNRWSP |
Parental | TYDVSSILTSIQ |
T.DVSSI.TSIQ | |
Retrocopy | TDDVSSIFTSIQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 16 .92 RPM |
SRP012922_cerebellum | 0 .14 RPM | 22 .82 RPM |
SRP012922_heart | 0 .46 RPM | 12 .99 RPM |
SRP012922_kidney | 0 .00 RPM | 11 .77 RPM |
SRP012922_liver | 0 .00 RPM | 11 .92 RPM |
SRP012922_lung | 0 .15 RPM | 20 .16 RPM |
SRP012922_quadricep_muscle | 0 .52 RPM | 23 .54 RPM |
SRP012922_spleen | 0 .23 RPM | 14 .88 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000001079 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005098 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000011908 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007060 | 1 retrocopy |
retro_dnov_215 ,
|
Macropus eugenii | ENSMEUG00000003026 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000010209 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000016739 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000024335 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000005045 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012621 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000000888 | 1 retrocopy |