RetrogeneDB ID: | retro_dnov_234 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_2887:22623..22827(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000018227 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 73.53 % |
Parental protein coverage: | 60.71 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | GGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDI |
G.AEGG.GKRKRLFSKEL....YGFG.D.NPYT..VDILEDLV.EFI.EMTHKAMSIG....VQ.ED. | |
Retrocopy | GAAEGGPGKRKRLFSKEL*RKVYGFGNDKNPYTKPVDILEDLVKEFIPEMTHKAMSIGKHDQVQGEDL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 3 .11 RPM |
SRP012922_cerebellum | 0 .00 RPM | 7 .01 RPM |
SRP012922_heart | 0 .00 RPM | 1 .86 RPM |
SRP012922_kidney | 0 .00 RPM | 7 .67 RPM |
SRP012922_liver | 0 .00 RPM | 3 .41 RPM |
SRP012922_lung | 0 .00 RPM | 4 .58 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 1 .90 RPM |
SRP012922_spleen | 0 .00 RPM | 2 .40 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000004542 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000019855 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000003347 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000002701 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000001081 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000018227 | 16 retrocopies | |
Loxodonta africana | ENSLAFG00000011432 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000008725 | 5 retrocopies | |
Mus musculus | ENSMUSG00000048100 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000002350 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013494 | 6 retrocopies | |
Procavia capensis | ENSPCAG00000005773 | 1 retrocopy | |
Sorex araneus | ENSSARG00000008033 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000006839 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000011144 | 8 retrocopies | |
Tursiops truncatus | ENSTTRG00000003167 | 1 retrocopy |