RetrogeneDB ID: | retro_dnov_80 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_1346:234437..234620(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PPP1R14C | ||
Ensembl ID: | ENSDNOG00000017261 | ||
Aliases: | None | ||
Description: | protein phosphatase 1, regulatory (inhibitor) subunit 14C [Source:HGNC Symbol;Acc:14952] |
Percent Identity: | 53.23 % |
Parental protein coverage: | 72.09 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | CQEEEMPDVEIDIDDLLDADSEEERALKLQEALIDCYKPTEEFIKELLSRIRGMRKLSPPQK |
CQEEE.P..E.D.D.LLD..S....A....E.L.DCYKPTE.F...LL..I.GM.KLS.P.. | |
Retrocopy | CQEEELPEEEMDVDELLDMESDATWAARVEEMLADCYKPTEAF-SGLLDKILGMQKLSTPRR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .19 RPM | 2 .14 RPM |
SRP012922_cerebellum | 0 .14 RPM | 1 .51 RPM |
SRP012922_heart | 0 .00 RPM | 9 .28 RPM |
SRP012922_kidney | 0 .27 RPM | 3 .29 RPM |
SRP012922_liver | 0 .15 RPM | 0 .00 RPM |
SRP012922_lung | 0 .15 RPM | 7 .94 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 24 .23 RPM |
SRP012922_spleen | 0 .46 RPM | 0 .23 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000026586 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000017261 | 2 retrocopies |
retro_dnov_1661, retro_dnov_80 ,
|
Myotis lucifugus | ENSMLUG00000023245 | 2 retrocopies | |
Mus musculus | ENSMUSG00000040653 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000017102 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000002873 | 1 retrocopy |