RetrogeneDB ID: | retro_dnov_931 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_1230:4882..5313(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GTF3C6 | ||
Ensembl ID: | ENSDNOG00000014270 | ||
Aliases: | None | ||
Description: | general transcription factor IIIC, polypeptide 6, alpha 35kDa [Source:HGNC Symbol;Acc:20872] |
Percent Identity: | 64.86 % |
Parental protein coverage: | 69.67 % |
Number of stop codons detected: | 5 |
Number of frameshifts detected | 1 |
Parental | DTLGTCVIFEENVEHVDAEGNNKTVLKYKYHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRP |
D.L...V.FE.NVEHVDAE.N.KT.LKYK.HT.......R.......EG..NIGG.E.L.IKDNDFSYRP | |
Retrocopy | DILWI*VLFEVNVEHVDAEDNKKTMLKYKSHTRSSA*QERS---DRREGRRNIGGIE*L*IKDNDFSYRP |
Parental | NMICSFIHENEDEEVVAPAADKPLELEEQEIQMKD-NSNLNYEQGKPLHLEIEDSGPLIDIPSSETEDFV |
.M.CSF.HE.EDEEVV.P..DKP.ELEEQE..MKD..SNLNYEQGKPLHLEIEDSG..I.IPS.ETE..V | |
Retrocopy | SMFCSFLHEYEDEEVVVPTPDKPVELEEQES*MKD<HSNLNYEQGKPLHLEIEDSGLPINIPSYETEGSV |
Parental | LMETQMLP |
.ME....P | |
Retrocopy | FMESKDAP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 9 .14 RPM |
SRP012922_cerebellum | 0 .00 RPM | 14 .71 RPM |
SRP012922_heart | 0 .00 RPM | 9 .28 RPM |
SRP012922_kidney | 0 .00 RPM | 4 .38 RPM |
SRP012922_liver | 0 .00 RPM | 7 .28 RPM |
SRP012922_lung | 0 .00 RPM | 9 .01 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 6 .92 RPM |
SRP012922_spleen | 0 .00 RPM | 14 .99 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003535 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005248 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000014270 | 4 retrocopies | |
Homo sapiens | ENSG00000155115 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000010681 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000013919 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012709 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000017924 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000010179 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000012846 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000018502 | 3 retrocopies |