RetrogeneDB ID: | retro_dord_762 | ||
Retrocopylocation | Organism: | Kangaroo rat (Dipodomys ordii) | |
Coordinates: | scaffold_81286:3440..3679(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Isca2 | ||
Ensembl ID: | ENSDORG00000014857 | ||
Aliases: | None | ||
Description: | iron-sulfur cluster assembly 2 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1921566] |
Percent Identity: | 71.6 % |
Parental protein coverage: | 51.95 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | SPIAAAALRAAIPW-RRSRILLISPGLQRRWDASSSNSEAGEEQIRLTDSCVRRLLEITEGSEFLRLQVE |
S...A.AL...IP..RRSR.LLI.PGLQR.WDAS.SNSEA.E.Q....DSCVRRLLEITEGSEFLRLQVE | |
Retrocopy | SGLRAVALQVVIPC<RRSRFLLIFPGLQRHWDASPSNSEASEAQTHFMDSCVRRLLEITEGSEFLRLQVE |
Parental | GGGCSGFQYKF |
GG.CSGFQ... | |
Retrocopy | GGACSGFQSSY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000020479 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000014857 | 1 retrocopy |
retro_dord_762 ,
|
Gorilla gorilla | ENSGGOG00000012894 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006566 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016268 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000011684 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000006536 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012085 | 1 retrocopy |