RetrogeneDB ID: | retro_dord_788 | ||
Retrocopylocation | Organism: | Kangaroo rat (Dipodomys ordii) | |
Coordinates: | scaffold_98810:355..574(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Cript | ||
Ensembl ID: | ENSDORG00000006085 | ||
Aliases: | None | ||
Description: | cysteine-rich PDZ-binding protein [Source:MGI Symbol;Acc:MGI:1929655] |
Percent Identity: | 95.89 % |
Parental protein coverage: | 72.28 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQ |
SG..KLNENKALTSKKARF.PYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQ | |
Retrocopy | SGRGKLNENKALTSKKARFGPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQ |
Parental | TSV |
TSV | |
Retrocopy | TSV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000015723 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000002633 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000000556 | 7 retrocopies | |
Cavia porcellus | ENSCPOG00000008081 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000006085 | 1 retrocopy |
retro_dord_788 ,
|
Equus caballus | ENSECAG00000012342 | 2 retrocopies | |
Felis catus | ENSFCAG00000015610 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000009133 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004193 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000005388 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000973 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008089 | 6 retrocopies | |
Rattus norvegicus | ENSRNOG00000015215 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000002853 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000000315 | 1 retrocopy |