RetrogeneDB ID: | retro_ecab_366 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 16:72779013..72779253(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CRIPT | ||
| Ensembl ID: | ENSECAG00000012342 | ||
| Aliases: | None | ||
| Description: | cysteine-rich PDZ-binding protein [Source:HGNC Symbol;Acc:14312] |
| Percent Identity: | 71.25 % |
| Parental protein coverage: | 79.21 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSH |
| VC.KC.KKLGT.I........ARNTTE.GGRKLN.NKALTSK.A...PYGK.K.STCRIC.SS.HQ.GSH | |
| Retrocopy | VCRKCAKKLGTIILQIHIFPCARNTTEIGGRKLNKNKALTSKEAKVNPYGKKKPSTCRICESSLHQLGSH |
| Parental | YCQGCAYKKG |
| YCQGCA.KKG | |
| Retrocopy | YCQGCAHKKG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 2 .24 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 3 .53 RPM |
| SRP021940_embryo | 0 .00 RPM | 2 .28 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 5 .53 RPM |
| SRP021940_synovial_membrane | 0 .14 RPM | 2 .31 RPM |
| SRP021940_testis | 0 .00 RPM | 2 .43 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015723 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000002633 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000556 | 7 retrocopies | |
| Cavia porcellus | ENSCPOG00000008081 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000006085 | 1 retrocopy | |
| Equus caballus | ENSECAG00000012342 | 2 retrocopies |
retro_ecab_310, retro_ecab_366 ,
|
| Felis catus | ENSFCAG00000015610 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000009133 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004193 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005388 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000973 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008089 | 6 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015215 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002853 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000000315 | 1 retrocopy |