RetrogeneDB ID: | retro_drer_34 | ||
Retrocopylocation | Organism: | Zebrafish (Danio rerio) | |
Coordinates: | 5:7856767..7856936(+) | ||
Located in intron of: | ENSDARG00000042909 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CABZ01062563.1 | ||
Ensembl ID: | ENSDARG00000086035 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.33 % |
Parental protein coverage: | 56.86 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | SIHPSIHAILLPSVCLLFHPSIHPSIHPS-IHPSIHPFIHPSIYPSI-PHFVYCSIHPSM |
S.H.S..A..L.SVCL.FHPSIHPS...S.I.....PFIHPSI..S..P.F..C.I..S. | |
Retrocopy | SVHHSSNA*YL-SVCLFFHPSIHPSVYLS<INLLFCPFIHPSIILSV<PSFI*CLISVSV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Danio rerio | ENSDARG00000086035 | 3 retrocopies |
retro_drer_25, retro_drer_34 , retro_drer_37,
|
Danio rerio | ENSDARG00000090390 | 1 retrocopy | |
Ficedula albicollis | ENSFALG00000013753 | 1 retrocopy |