RetrogeneDB ID: | retro_ecab_1095 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | X:124060324..124060561(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DPH3 | ||
Ensembl ID: | ENSECAG00000016591 | ||
Aliases: | None | ||
Description: | diphthamide biosynthesis 3 [Source:HGNC Symbol;Acc:27717] |
Percent Identity: | 65.82 % |
Parental protein coverage: | 91.46 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | EVEIEDFQYDEDSETYFYPCPCGDNF----CITKEDLENGEDVATCPSCSLIIKVIYDKDQFMCGETVPA |
.V.I.D.QY....E.YFYPC.C.DNF......TKE.LENGE.VATCP.CSLIIKVI.DK.QFMC.ET.PA | |
Retrocopy | KVGIMDLQYNHSLEMYFYPCTCRDNFFGHLILTKEELENGENVATCPGCSLIIKVIDDKGQFMCRETIPA |
Parental | PSTNKELVK |
PST.K.LV. | |
Retrocopy | PSTSK*LVE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 2 .30 RPM |
SRP021940_cerebellum | 0 .00 RPM | 2 .08 RPM |
SRP021940_embryo | 0 .00 RPM | 6 .83 RPM |
SRP021940_placental_villous | 0 .00 RPM | 3 .37 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 2 .17 RPM |
SRP021940_testis | 0 .00 RPM | 9 .21 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003916 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000005881 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
Equus caballus | ENSECAG00000016591 | 1 retrocopy |
retro_ecab_1095 ,
|
Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
Felis catus | ENSFCAG00000006355 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
Mus musculus | ENSMUSG00000021905 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |