RetrogeneDB ID: | retro_mmus_196 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 13:106546811..106547060(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000059877 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Dph3 | ||
Ensembl ID: | ENSMUSG00000021905 | ||
Aliases: | Dph3, DELGIP1, DelgipP1, Desr1, KTI11, Zcsl2 | ||
Description: | DPH3 homolog (KTI11, S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1922658] |
Percent Identity: | 82.93 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITKEDLENGEDVATCPSCSLIIKVIYDKDQFMCGETV |
MAVFHDEV...DFQYDED.ETYF.PCPCGD...ITKEDLENGEDVA.CP.CSLIIKVIYDKDQFMCGE.V | |
Retrocopy | MAVFHDEVKNKDFQYDEDLETYFCPCPCGDSLSITKEDLENGEDVAMCPKCSLIIKVIYDKDQFMCGEIV |
Parental | PAPSTNKELVKC |
.APS.NKELV.C | |
Retrocopy | LAPSSNKELVRC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 21 .54 RPM |
SRP007412_cerebellum | 0 .00 RPM | 28 .35 RPM |
SRP007412_heart | 0 .00 RPM | 16 .37 RPM |
SRP007412_kidney | 0 .00 RPM | 19 .88 RPM |
SRP007412_liver | 0 .00 RPM | 10 .35 RPM |
SRP007412_testis | 0 .00 RPM | 25 .66 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003916 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000005881 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000012030 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011642 | 1 retrocopy | |
Equus caballus | ENSECAG00000016591 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000009790 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000016272 | 1 retrocopy | |
Felis catus | ENSFCAG00000006355 | 1 retrocopy | |
Homo sapiens | ENSG00000154813 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000022108 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000025650 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000022692 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000025472 | 3 retrocopies | |
Mus musculus | ENSMUSG00000021905 | 1 retrocopy |
retro_mmus_196 ,
|
Nomascus leucogenys | ENSNLEG00000001096 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000014083 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014671 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000011675 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000007739 | 3 retrocopies |