RetrogeneDB ID: | retro_ecab_552 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 20:26088363..26088576(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSECAG00000012046 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.69 % |
| Parental protein coverage: | 77.17 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD |
| LRKMVKKIEIS.HA.YTCSFCGKTK.KRRAVGI.HCGSCMKT.AG...T.N..SAVT.KSAIRRLKEL.D | |
| Retrocopy | LRKMVKKIEISRHAMYTCSFCGKTKRKRRAVGICHCGSCMKTAAGVTLTCNPSSAVTAKSAIRRLKELTD |
| Parental | Q |
| Q | |
| Retrocopy | Q |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 721 .05 RPM |
| SRP021940_cerebellum | 0 .05 RPM | 396 .92 RPM |
| SRP021940_embryo | 0 .00 RPM | 399 .91 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 333 .70 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 544 .29 RPM |
| SRP021940_testis | 3 .33 RPM | 352 .52 RPM |