RetrogeneDB ID: | retro_ecab_700 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 29:10873767..10873992(-) | ||
Located in intron of: | ENSECAG00000019202 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSECAG00000005108 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 68. % |
Parental protein coverage: | 73.53 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ITLVGVVVAVVMYVQKKKRVDRLRHHLLPMYSYDPAEELHEAEQELLSDVGDPKVVHGWQSGYQHKRMPL |
..L.G.....VMY.QKKK..D.L.HHLLPMY.Y.P..ELHEAEQELLSD.G..KV.HGWQ.GYQHK.M.L | |
Retrocopy | VFLLGLQWWEVMYAQKKKQADQLCHHLLPMYCYNPTKELHEAEQELLSDLGGTKVAHGWQGGYQHKQMLL |
Parental | LDVKT |
LDVKT | |
Retrocopy | LDVKT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 1 .30 RPM |
SRP021940_cerebellum | 0 .00 RPM | 10 .65 RPM |
SRP021940_embryo | 0 .03 RPM | 2 .25 RPM |
SRP021940_placental_villous | 0 .00 RPM | 5 .10 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 3 .68 RPM |
SRP021940_testis | 0 .00 RPM | 3 .26 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001058 | 1 retrocopy | |
Bos taurus | ENSBTAG00000034519 | 1 retrocopy | |
Equus caballus | ENSECAG00000005108 | 3 retrocopies |
retro_ecab_236, retro_ecab_474, retro_ecab_700 ,
|
Myotis lucifugus | ENSMLUG00000011876 | 1 retrocopy | |
Mus musculus | ENSMUSG00000062753 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000013398 | 1 retrocopy | |
Pelodiscus sinensis | ENSPSIG00000004692 | 1 retrocopy |