RetrogeneDB ID: | retro_psin_32 | ||
Retrocopylocation | Organism: | Chinese softshell turtle (Pelodiscus sinensis) | |
Coordinates: | JH206258.1:1550419..1550656(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPSIG00000004692 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 77.22 % |
Parental protein coverage: | 78.22 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | TTPSSARTSSDSLVGYVLVPFFLITVVGIVVAVMMYIQKKRRFDRLRHHLLPMYSYDPAEDLHEVEQELL |
.TP...RTS.DSLVGY.LVPFFLITV.GIV..VMMY.QKKRRFDRLRHHLLP.YS.DP..DLHE.EQELL | |
Retrocopy | STPTATRTSNDSLVGYILVPFFLITVIGIVLVVMMYFQKKRRFDRLRHHLLPVYSHDPTGDLHEAEQELL |
Parental | GDPDDTKVM |
.DPDDTK.. | |
Retrocopy | EDPDDTKMI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001058 | 1 retrocopy | |
Bos taurus | ENSBTAG00000034519 | 1 retrocopy | |
Equus caballus | ENSECAG00000005108 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000011876 | 1 retrocopy | |
Mus musculus | ENSMUSG00000062753 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000013398 | 1 retrocopy | |
Pelodiscus sinensis | ENSPSIG00000004692 | 1 retrocopy |
retro_psin_32 ,
|