RetrogeneDB ID: | retro_ecab_940 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 7:85423425..85423722(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PDZD11 | ||
Ensembl ID: | ENSECAG00000010771 | ||
Aliases: | None | ||
Description: | PDZ domain containing 11 [Source:HGNC Symbol;Acc:28034] |
Percent Identity: | 76.77 % |
Parental protein coverage: | 70.71 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | RVYHPDYNNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVND |
RVY....NNEL..FLPRI.TLKKPPGAQ.GFNIRG.KASQL.IFIS.VIP.S.AH.AGLQEG.QVLAVND | |
Retrocopy | RVYRACCNNELSHFLPRIITLKKPPGAQWGFNIRGRKASQLSIFISTVIPGSEAH*AGLQEGNQVLAVND |
Parental | VDFQDIEHSKAVEILKTAREISMRVRFFP |
VDFQD.EHSKAVEILKT..EISM.....P | |
Retrocopy | VDFQDLEHSKAVEILKTTHEISMHACLLP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 7 .20 RPM |
SRP021940_cerebellum | 0 .00 RPM | 23 .63 RPM |
SRP021940_embryo | 0 .08 RPM | 23 .42 RPM |
SRP021940_placental_villous | 0 .00 RPM | 22 .32 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 12 .60 RPM |
SRP021940_testis | 0 .06 RPM | 11 .57 RPM |
Species | RetrogeneDB ID |
---|---|
Bos taurus | retro_btau_594 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009203 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000028800 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000012432 | 1 retrocopy | |
Equus caballus | ENSECAG00000010771 | 1 retrocopy |
retro_ecab_940 ,
|
Echinops telfairi | ENSETEG00000008626 | 3 retrocopies | |
Homo sapiens | ENSG00000120509 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006626 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000012040 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000013938 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000004220 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000863 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016423 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000020929 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021995 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000005380 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000002767 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000007864 | 1 retrocopy |