RetrogeneDB ID: | retro_eeur_233 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_215989:7565..7789(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PARK7 | ||
Ensembl ID: | ENSEEUG00000013141 | ||
Aliases: | None | ||
Description: | parkinson protein 7 [Source:HGNC Symbol;Acc:16369] |
Percent Identity: | 80.26 % |
Parental protein coverage: | 69.81 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | KEGPYDVVVLPGGNLGAQNL-AKSAVVK-EILKDQEKRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAK |
.EGPYDVVVLPGGNLGAQNL.AKSAVVK.EILK.QEK.K.L.AAICA.P..LLAHE..FGSK.TTHPL.K | |
Retrocopy | QEGPYDVVVLPGGNLGAQNLVAKSAVVK<EILKGQEKQKDLLAAICACPITLLAHEMSFGSKDTTHPLTK |
Parental | DKMMNG |
DKMM.G | |
Retrocopy | DKMMSG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 29 .01 RPM |
SRP017611_kidney | 0 .00 RPM | 148 .53 RPM |
SRP017611_liver | 0 .00 RPM | 22 .03 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003703 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000019674 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000004364 | 7 retrocopies | |
Callithrix jacchus | ENSCJAG00000000319 | 4 retrocopies | |
Erinaceus europaeus | ENSEEUG00000013141 | 1 retrocopy |
retro_eeur_233 ,
|
Echinops telfairi | ENSETEG00000010915 | 1 retrocopy | |
Homo sapiens | ENSG00000116288 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000012105 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000008470 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008790 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016511 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002151 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000001925 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000000102 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000018289 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000009474 | 13 retrocopies | |
Tarsius syrichta | ENSTSYG00000001455 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000011076 | 1 retrocopy |