RetrogeneDB ID: | retro_eeur_367 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_272061:13968..14196(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS10 | ||
Ensembl ID: | ENSEEUG00000003376 | ||
Aliases: | None | ||
Description: | ribosomal protein S10 [Source:HGNC Symbol;Acc:10383] |
Percent Identity: | 66.23 % |
Parental protein coverage: | 50.66 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | IQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARFTRGEADRDTYRRSAVPPGADKKAEAGAG |
..Y.R.YL..P....P.T........GRP.PKGLEGERPARFT.GEADRDTYRRS.V.PG..KKAEAGAG | |
Retrocopy | VSYQRGYL-VPLRLPPSTP*DCAWNPGRPWPKGLEGERPARFTGGEADRDTYRRSSVIPGVNKKAEAGAG |
Parental | SATEFQF |
SA.EFQF | |
Retrocopy | SAAEFQF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 34 .97 RPM |
SRP017611_kidney | 0 .00 RPM | 97 .52 RPM |
SRP017611_liver | 0 .00 RPM | 69 .29 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Erinaceus europaeus | ENSEEUG00000003376 | 2 retrocopies |
retro_eeur_367 , retro_eeur_647,
|
Latimeria chalumnae | ENSLACG00000017219 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000008539 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000013929 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000016516 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000000731 | 3 retrocopies |