RetrogeneDB ID: | retro_etel_2111 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_63654:2846..3143(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NUDT4 | ||
Ensembl ID: | ENSETEG00000013922 | ||
Aliases: | None | ||
Description: | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Source:HGNC Symbol;Acc:8051] |
Percent Identity: | 72.82 % |
Parental protein coverage: | 69.59 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTEILED |
SSSR.PD.W.VPGGG.EP.EEP..AAVR.V.EEAG.K...G.L.G.FE.NQ.RKHRTYVYVL.VTE.LED | |
Retrocopy | SSSRHPDRWVVPGGGPEPTEEPSVAAVRAVCEEAGGK---GALVGIFE-NQVRKHRTYVYVLIVTEVLED |
Parental | WEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEY |
.EDSV.IGRKREWFK.EDAI.VLQ.H.PV.A.Y | |
Retrocopy | REDSVSIGRKREWFKIEDAIQVLQHHTPVQASY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009844 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000015207 | 3 retrocopies | |
Dipodomys ordii | ENSDORG00000000647 | 3 retrocopies | |
Equus caballus | ENSECAG00000019319 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000013922 | 2 retrocopies |
retro_etel_1627, retro_etel_2111 ,
|
ENSG00000173598 | 0 retrocopies |
|
|
Gorilla gorilla | ENSGGOG00000014324 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000013776 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000007100 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000002767 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000009468 | 1 retrocopy | |
Mus musculus | ENSMUSG00000020029 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000011283 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000013730 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000020306 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000012198 | 7 retrocopies | |
Tursiops truncatus | ENSTTRG00000003309 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000002957 | 1 retrocopy |