RetrogeneDB ID: | retro_fcat_1772 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | F1:16496640..16497048(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000031337 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 56.74 % |
| Parental protein coverage: | 74.19 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | PARMAAVVLGRDTMGPERIFPNQTEELGPHQGPTEGTG-DWSSEEPEEEQEETGAGPAGYSYQPLNQDPE |
| PAR.AA.VL..D..GPE..FP...EE.GPHQ.P.EG.G.D.S.EEP.EEQ.E.GAGPAGYSYQ..NQD.E | |
| Retrocopy | PARRAAGVLWGDRVGPEHTFPGESEERGPHQSPAEGVG<D*STEEPREEQGEVGAGPAGYSYQAPNQDAE |
| Parental | -PEEVELA-PVGDGEDVVADIQDRIQALGLHLPDPPLESEDEEEEGATGLSNHSSIPMDPEHVELVKRTM |
| ..EE.E.A...GDG....AD.Q..IQ.LGLH.PD..L......E...T..SNHSS..M.PEH..LV.R.. | |
| Retrocopy | <TEEAEPA<TMGDG-GRAADTQNWIQVLGLHRPDSQLRVRMKMEREPTAQSNHSSVSMRPEHAKLVRRAK |
| Parental | A |
| A | |
| Retrocopy | A |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .11 RPM | 47 .97 RPM |
| SRP017611_kidney | 0 .00 RPM | 39 .57 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012655 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000005536 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000001756 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004894 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000022111 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000002439 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031337 | 1 retrocopy |
retro_fcat_1772 ,
|
| Loxodonta africana | ENSLAFG00000013881 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012138 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000019002 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001565 | 2 retrocopies | |
| Pelodiscus sinensis | ENSPSIG00000002330 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008711 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017144 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000012294 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006996 | 1 retrocopy |