RetrogeneDB ID: | retro_ggor_1173 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 15:4658629..4658869(-) | ||
| Located in intron of: | ENSGGOG00000012936 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS18C | ||
| Ensembl ID: | ENSGGOG00000008603 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.75 % |
| Parental protein coverage: | 63.93 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAAMVAVCGGLRRKKLTHLVTAAVSLTHPGTQTVLWRRGCSQ--QVSSNEDLPISMENPYKEPLKKCILC |
| MA..VA.C.GL.RKKLTHLV.AAVSLTHP.T..VLWRRGCSQ..Q.SSNEDLPI.MEN.YKE.LKKCILC | |
| Retrocopy | MATIVALCSGLGRKKLTHLVMAAVSLTHPRTHMVLWRRGCSQYKQISSNEDLPIPMENSYKEALKKCILC |
| Parental | GKHVDYKNVQ |
| GK.VD.KNVQ | |
| Retrocopy | GKQVDFKNVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .97 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 5 .44 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .85 RPM |
| SRP007412_kidney | 0 .00 RPM | 14 .43 RPM |
| SRP007412_liver | 0 .00 RPM | 9 .36 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .26 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1540 |
| Pan troglodytes | retro_ptro_1039 |
| Pongo abelii | retro_pabe_1276 |
| Macaca mulatta | retro_mmul_2203 |