RetrogeneDB ID: | retro_cpor_178 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_1:48402480..48402683(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPS18C | ||
Ensembl ID: | ENSCPOG00000009198 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 52.7 % |
Parental protein coverage: | 50.69 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | TMENPYKEPLKKCILCGKRVDYKNVQLLSQFISAYTGCIHGRHITGLCGKKQKEISKAIKRAQ-VMGFMP |
..E.P.......C......V.YK.VQLLSQF.S.YTGC.HGRHITGL........SKAIKRA...MG.MP | |
Retrocopy | SLEGPFXXXXASCVA---NVEYKPVQLLSQFMSSYTGCVHGRHITGL--*EETKVSKAIKRAR<IMGLMP |
Parental | VTHK |
V..K | |
Retrocopy | VIYK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .40 RPM | 17 .08 RPM |
SRP017611_kidney | 0 .21 RPM | 12 .25 RPM |
SRP017611_liver | 0 .22 RPM | 16 .10 RPM |
SRP040447_lung | 0 .23 RPM | 9 .99 RPM |
SRP040447_skeletal_muscle | 0 .31 RPM | 12 .60 RPM |