RetrogeneDB ID: | retro_ggor_136 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 4:55009207..55009369(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSGGOG00000023237 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSGGOG00000026329 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.22 % |
Parental protein coverage: | 98.18 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MEWNGINRSTMEWNGMEWNGMEWNRIEWNGMEWNQPEWNGIQWNGMEWNGMEWN |
.E.NG.....MEWNGME.NG.EW...EWNG.EWNQPEWNG..WNGMEWNGMEWN | |
Retrocopy | IERNGMEWNGMEWNGMEPNGIEWVGMEWNGREWNQPEWNGMEWNGMEWNGMEWN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Gorilla gorilla | ENSGGOG00000024231 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000026329 | 1 retrocopy |
retro_ggor_136 ,
|