RetrogeneDB ID: | retro_ggor_2990 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | X:38905292..38905660(-) | ||
Located in intron of: | ENSGGOG00000011703 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TDGF1 | ||
Ensembl ID: | ENSGGOG00000003453 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.43 % |
Parental protein coverage: | 66.49 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | SQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKC |
S..VP.MGIQ.SKE.NRTCCLN.GTC.LG.FC..P.S.YG.NCEH.V..E.CGSV.HD.WLPK..S.CKC | |
Retrocopy | SEFVPSMGIQDSKERNRTCCLNEGTCTLGCFCVFPSS-YGWNCEHVVCRESCGSVHHDIWLPKMRSMCKC |
Parental | WHGQLRCFPQAFLPGCDGLVMDEHLVASRTPE-LPPSARTTTFMLVGICLSIQSYY |
WHGQ..CFP.AFLPGCDGLVM.EHL.A.RT.E...PSA..TTFML.G.CLSIQSYY | |
Retrocopy | WHGQPLCFPEAFLPGCDGLVMFEHLMAPRTLE<ILPSA-CTTFMLAGTCLSIQSYY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .12 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .82 RPM |
SRP007412_liver | 0 .03 RPM | 0 .42 RPM |
SRP007412_testis | 0 .00 RPM | 0 .31 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4804 |
Pan troglodytes | retro_ptro_3194 |
Macaca mulatta | retro_mmul_2560 |
Callithrix jacchus | retro_cjac_4151 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000002174 | 3 retrocopies | |
Felis catus | ENSFCAG00000014508 | 1 retrocopy | |
Homo sapiens | ENSG00000241186 | 7 retrocopies | |
Gorilla gorilla | ENSGGOG00000003453 | 5 retrocopies | |
Loxodonta africana | ENSLAFG00000009140 | 4 retrocopies | |
Microcebus murinus | ENSMICG00000016492 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000003088 | 6 retrocopies | |
Mustela putorius furo | ENSMPUG00000015167 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032494 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006143 | 6 retrocopies | |
Otolemur garnettii | ENSOGAG00000017039 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014854 | 7 retrocopies | |
Tarsius syrichta | ENSTSYG00000013609 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000017299 | 1 retrocopy |