RetrogeneDB ID: | retro_ggor_489 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:224138041..224138317(-) | ||
Located in intron of: | ENSGGOG00000007722 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FABP7 | ||
Ensembl ID: | ENSGGOG00000025475 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.83 % |
Parental protein coverage: | 67.42 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SQEGDKVVIRTLSTFKNTEISFHLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGK |
S....KVVIR..S.FKNTE.SFH.GEEFDETT.DDRNCK.VVSLD.DKL.HIQKWD.KET.F.REIK.G. | |
Retrocopy | SRRRQKVVIRIQSMFKNTEVSFHMGEEFDETTTDDRNCKFVVSLDRDKLIHIQKWDDKETYFIREIKYGE |
Parental | MVMTL--TFG-DVVAVRHYEKA |
MVMT....FG.DVVAV.HY.KA | |
Retrocopy | MVMTYFWCFGDDVVAVHHYKKA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 28 .68 RPM |
SRP007412_cerebellum | 0 .28 RPM | 73 .12 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .04 RPM |
SRP007412_liver | 0 .00 RPM | 0 .03 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_536 |
Pan troglodytes | retro_ptro_402 |
Pongo abelii | retro_pabe_213 |
Macaca mulatta | retro_mmul_458 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000014056 | 1 retrocopy | |
Homo sapiens | ENSG00000164434 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000005964 | 8 retrocopies | |
Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016835 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000025475 | 1 retrocopy |
retro_ggor_489 ,
|
Macaca mulatta | ENSMMUG00000021907 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000001497 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000031110 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000000992 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016979 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000018564 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000003313 | 1 retrocopy |