RetrogeneDB ID: | retro_ggor_2276 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 5:78954547..78954793(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP5 | ||
| Ensembl ID: | ENSGGOG00000005964 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.05 % |
| Parental protein coverage: | 73.87 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | IKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMN |
| I.TESTLK.TQFSCTL.EKFEETTA..RKTQTV.NF..G.LVQHQEW.GKESTITRKLK.GKL.V.C..N | |
| Retrocopy | INTESTLKPTQFSCTLVEKFEETTANSRKTQTVHNFIHGTLVQHQEWKGKESTITRKLKNGKLMVDCILN |
| Parental | NVTCTRIYEKVE |
| NVTCT..Y.KVE | |
| Retrocopy | NVTCTQVYKKVE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 8 .68 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .18 RPM |
| SRP007412_heart | 0 .00 RPM | 20 .67 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .65 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .19 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .39 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3357 |
| Pan troglodytes | retro_ptro_2131 |
| Macaca mulatta | retro_mmul_2095 |
| Callithrix jacchus | retro_cjac_1832 |