RetrogeneDB ID: | retro_hvul_97 | ||
Retrocopylocation | Organism: | Barley (Hordeum vulgare) | |
Coordinates: | 7:37627163..37627403(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | MLOC_14907 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 61.25 % |
Parental protein coverage: | 88.76 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MGKRKA-AAKPPPRKRMDKLDTVFSCPFCNHGSSVECRIDMKNLIGEANCQICQESFSTTANALTEAIDI |
MGKRK...AK..PRK...KLDT.F.CPFCNH..S..C.ID.K....EA.C..C.ES.STTA.ALTE..D. | |
Retrocopy | MGKRKSTSAKTAPRKKAEKLDTTFCCPFCNHPGSIDCKIDLKHMVAEASCSACLESYSTTAHALTEPVDV |
Parental | YSEWIDECER |
Y.EWIDECE. | |
Retrocopy | YAEWIDECEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Oryza sativa indica | BGIOSGA007878 | 1 retrocopy | |
Hordeum vulgare | MLOC_14907 | 3 retrocopies |
retro_hvul_85, retro_hvul_89, retro_hvul_97 ,
|
Oryza barthii | OBART07G23140 | 1 retrocopy | |
Oryza glumaepatula | OGLUM07G23200 | 1 retrocopy | |
Oryza nivara | ONIVA07G23000 | 1 retrocopy | |
Oryza sativa japonica | OS07G0631100 | 1 retrocopy | |
Sorghum bicolor | Sb10g003710 | 1 retrocopy | |
Setaria italica | Si007595m.g | 2 retrocopies | |
Triticum aestivum | Traes_1DL_84C83461E | 2 retrocopies |