RetrogeneDB ID: | retro_itri_240 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393281.1:12586363..12586588(+) | ||
Located in intron of: | ENSSTOG00000000280 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPL17 | ||
Ensembl ID: | ENSSTOG00000003313 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein L17 [Source:HGNC Symbol;Acc:14053] |
Percent Identity: | 72. % |
Parental protein coverage: | 60.66 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | HERIEASWARVDEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFQVLAPRFQDQNGGYTR-M |
.E.I..SW.RVD.MRGY.E..ID.GKL.DTN..AM.MADFWLTEKD.IPK.FQVL.P.FQ.QNGGYTR.. | |
Retrocopy | NE*IQVSWVRVDKMRGYSEEFID*GKLRDTNK*AMSMADFWLTEKDSIPKQFQVLTPQFQYQNGGYTRTL |
Parental | LQIPN |
LQIPN | |
Retrocopy | LQIPN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000027536 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000013588 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000001144 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000005449 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000019497 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000024693 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003313 | 3 retrocopies |
retro_itri_1019, retro_itri_1156, retro_itri_240 ,
|